DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and MINDY4B

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001338210.2 Gene:MINDY4B / 646951 HGNCID:35475 Length:460 Species:Homo sapiens


Alignment Length:133 Identity:27/133 - (20%)
Similarity:41/133 - (30%) Gaps:51/133 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 GLGHTSLA-------PNI--TELQGLGIEFFLGLLLVLVVFGACDP-------------HKPDSR 164
            |.||...:       |:|  ::|.|..|...:...|..::||....             |.|.|.
Human    70 GQGHLPSSGLCSIPNPSIISSKLGGFPISLAMATKLRQILFGNTVHVFSYNWKKAYFRFHDPSSE 134

  Fly   165 YTAPLAIG--------MAV-----------------TLGHLGTIRYTGASMNPARTVGTAFATDI 204
            ....|.:|        |||                 .||:|..|    :.....:.:..|.|..:
Human   135 LAFTLEVGKGGARSIQMAVQGSIIKYLLFTRKGKDCNLGNLCEI----SKKEQEQALAAALAGIL 195

  Fly   205 WAS 207
            ||:
Human   196 WAA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 27/133 (20%)
MINDY4BNP_001338210.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..76 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.