DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp9

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001258772.1 Gene:Aqp9 / 64008 MGIID:1891066 Length:321 Species:Mus musculus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:115/275 - (41%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GN----LILNFFACGACTQIEDGTFKA-------LAFGLAIFMAITIVGHLSGGHVNPAVTAGML 83
            ||    |:|   .||:..|......||       :.|..|:.||:.....:||||:||||:..|.
Mouse    57 GNRDFYLVL---GCGSIAQAVLSREKAGGIITINIGFATAVVMALYATFGVSGGHINPAVSFAMC 118

  Fly    84 VAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL-----------GHTSLA------PN 131
            ..||:...:..|||..|.|||..|.|.|..:    ||:||           |....|      |.
Mouse   119 TFGRMEWFKFPFYVGAQLLGAFVGAATVFGI----YYDGLMAFADGKLLITGENGTAFIFATYPK 179

  Fly   132 -ITELQGLGIE-----FFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASM 190
             ...:.|..::     .|| ||:|..:|.:.:...|  |...|:.||:.:.:........:|.:|
Mouse   180 PFVSVPGAFVDQVVSTMFL-LLIVFAIFDSRNLGVP--RGLEPIVIGLLIIVISCSLGLNSGCAM 241

  Fly   191 NPARTVG----TA----------FATDIWASHWVYWVGPVLGGVAAALLYT---QVLEAKPVPKV 238
            ||||.:.    ||          |..:.|   |:..|||::|.|...|:|.   |:..:.|.|:|
Mouse   242 NPARDLSPRLFTALAGWGFEVFTFGNNFW---WIPVVGPMIGAVLGGLIYVLFIQMHHSNPDPEV 303

  Fly   239 NEASEKYRTHADERE 253
            .  :|....:.::.|
Mouse   304 K--AEPAENNLEKHE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 70/243 (29%)
Aqp9NP_001258772.1 MIP <61..292 CDD:294134 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.