DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp3b

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001159593.1 Gene:aqp3b / 568049 ZFINID:ZDB-GENE-040724-66 Length:299 Species:Danio rerio


Alignment Length:279 Identity:77/279 - (27%)
Similarity:115/279 - (41%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LWQALIGEFLGNLILNFFACGACTQI-----EDGTFKAL--AFGLAIFMAITIVGHLSGGHVNPA 77
            |.:..:.|.||.|||..|.|||..|.     ..|.|..:  |||.|..:.|.:.|.:||||:||.
Zfish    21 LMRQALAECLGTLILVMFGCGALAQHILSGGSHGMFLTVNFAFGFAATLGILVCGQVSGGHINPT 85

  Fly    78 VTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAV------------KILIDQDYYN---GLGHTS 127
            ||..:.:.||....:...|.:.|.:||..|...:            :..:|.|..|   |:..|.
Zfish    86 VTFSLCLLGREPWRKFPVYFLAQTVGAFLGAGIIFGMYFDAIWKFGQGSLDVDGVNATAGIFATY 150

  Fly   128 LAPNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGM-AVTLGHLGTIRYTGASM- 190
            .:.::|.|.|...:......|::.:....||      |..|:..|: |.|:|.:  :...|.|| 
Zfish   151 PSKHLTLLNGFFDQMIGTAALIVCILAIVDP------YNNPIPQGLEAFTVGFV--VLVIGLSMG 207

  Fly   191 -------NPARTVGTAFATDI--WASHWV----YW-----VGPVLGGVAAALLYTQVLEAKPVPK 237
                   ||||.:|....|.|  |.|...    ||     ..|.:|.|...::| |::....| |
Zfish   208 FNSGYAVNPARDLGPRIFTAIAGWGSKVFSAESYWSFVPVFAPFIGAVFGVMVY-QLMVGCHV-K 270

  Fly   238 VNEASEKYRTHADEREGCK 256
            ..|..::.....:|:|..|
Zfish   271 GEERDKREAVEREEKERLK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 69/247 (28%)
aqp3bNP_001159593.1 MIP 23..264 CDD:238204 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.