DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp8a.2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001073651.1 Gene:aqp8a.2 / 563130 ZFINID:ZDB-GENE-070112-1802 Length:257 Species:Danio rerio


Alignment Length:223 Identity:67/223 - (30%)
Similarity:102/223 - (45%) Gaps:7/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK---ALAFGLAIFMAITIVGHLSGGHVN 75
            :||..|::|..|.|.:|.....|..|.:..:..:...:   ||..|||:.:.:..:..:||.|.|
Zfish    26 QSKYERIFQPCIAELVGTTFFVFIGCVSVIENVEAAGRLQPALVHGLAVAVLVACMAEISGSHFN 90

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILI-DQDYYNGLGHTSLAPNITELQGLG 139
            |..|..:.:.|.:.|.....|::.|.:|.:.|.|..|::. |::|.|..|.........|..|..
Zfish    91 PPFTIAIWLCGGMQLTMVVPYLISQLIGGVLGAAMSKVMTSDENYANATGAAFAVLKSDEQLGKV 155

  Fly   140 I--EFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            :  |..:..|:.|||.......|..|. ..|..:|..|.:..|.....:|..:||||..|.|...
Zfish   156 VFAEMAMTCLVTLVVLMGAVNGKSKSP-MVPFMVGCTVIVNILAGGDVSGTCLNPARAFGPALVA 219

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVL 230
            :.|..||||||||:.||:.||.|...:|
Zfish   220 NHWTYHWVYWVGPLGGGLVAAALMRLLL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 65/217 (30%)
aqp8a.2NP_001073651.1 MIP 36..246 CDD:294134 62/210 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.