DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp8b

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001108382.2 Gene:aqp8b / 555598 ZFINID:ZDB-GENE-080220-47 Length:254 Species:Danio rerio


Alignment Length:226 Identity:64/226 - (28%)
Similarity:103/226 - (45%) Gaps:11/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNELKSKELRLWQALIGEFLGNLI-LNFFACGACTQI-----EDGTFK-ALAFGLAIFMAITIVG 67
            :.|.:.:|..|::.|:...:..|: ..||....|..:     |..|.: ||..|||:.:.|..:.
Zfish    15 VQETEMEEPGLFEQLVQPCMAELVGTAFFVLMGCLCVIESAQEGHTLQAALVHGLALAVVIGCMV 79

  Fly    68 HLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYY---NGLGHTSLA 129
            .:||.|.||:.|..:.::|.:.|.....|::.|..|.:.|....|.:...:.|   .|...|.|.
Zfish    80 EISGSHFNPSFTIAVFLSGGLELKMVLPYLISQVSGGLLGAVMAKGMTSSEKYAQAQGAAFTVLQ 144

  Fly   130 PNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPAR 194
            .:...::.|..|..:..|..|.|..:....| ...:..|..:|..|.:..|.....:||.:||.|
Zfish   145 ADDHIMKALFAEAAMTCLATLAVLLSAVNGK-SKNHMFPFLVGCTVMVNVLAGANVSGACLNPVR 208

  Fly   195 TVGTAFATDIWASHWVYWVGPVLGGVAAALL 225
            .:|.|..|:.|..||:|||||:.||:.||.|
Zfish   209 ALGPAVLTNYWTHHWIYWVGPITGGLIAAAL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 64/224 (29%)
aqp8bNP_001108382.2 MIP 33..243 CDD:294134 60/208 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.