DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001016845.1 Gene:aqp3 / 549599 XenbaseID:XB-GENE-488014 Length:294 Species:Xenopus tropicalis


Alignment Length:275 Identity:83/275 - (30%)
Similarity:118/275 - (42%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNELKSKELRLWQALIGEFLGNLILNFFACGACTQI-----EDGTFKA--LAFGLAIFMAITIVG 67
            |..|::|.||  ||| .|.||.|||..|.||:..|:     ..|.|..  ||||.|:.:.|.|.|
 Frog    14 LLRLRNKLLR--QAL-SECLGTLILVMFGCGSVAQVVLSKGSHGQFLTVNLAFGFAVMLGILISG 75

  Fly    68 HLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN----------- 121
            .:||||:|||||..:.:..|...|:...|...|.|||..|...:..|    ||:           
 Frog    76 QVSGGHLNPAVTFALCIMAREPWIKFPIYSFAQTLGAFLGAGIIYGL----YYDAIWFFGNDQLF 136

  Fly   122 --------GLGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDP-HKPDSRYTAPLAIGMAVTL 177
                    |:..|..:.::|.:.|...:|.....|::.|....|| :.|..|......:|..|.:
 Frog   137 VMGENGTAGIFTTFPSEHLTLINGFFDQFIGTAALIVCVLAIVDPNNNPIPRGLEAFTVGFVVLV 201

  Fly   178 GHLGTIR--YTGASMNPARTVGTAFATDI--------WASH---WVYWVGPVLGGVAAALLYTQV 229
              :||..  .:|.::||||..|....|.:        ||.:   ||..|.|:||.....|:|..:
 Frog   202 --IGTSMGFNSGYAVNPARDFGPRLFTSLAGWGTEVFWAGNQWWWVPIVSPLLGAFTGVLVYQLM 264

  Fly   230 ----LEAKPVPKVNE 240
                :|....|:..|
 Frog   265 IGCHIEPAQTPQSTE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 78/253 (31%)
aqp3NP_001016845.1 MIP 24..264 CDD:238204 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.