DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001005829.1 Gene:aqp1 / 448309 XenbaseID:XB-GENE-1217296 Length:274 Species:Xenopus tropicalis


Alignment Length:254 Identity:100/254 - (39%)
Similarity:150/254 - (59%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NELKSKELRLWQALIGEFLGNLILNFFACGAC------------------TQIEDGTFKALAFGL 57
            :|||.|  ..|:|:|.|||..::..|.:.||.                  |:.:|....:|||||
 Frog     3 SELKKK--AFWRAVIAEFLAMILFVFISIGAALGVQYPIPADAANATNTDTRQQDIVKVSLAFGL 65

  Fly    58 AIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNG 122
            ||......|||:||.|:|||||.|.|::.:||:::|..|::.|||||:.|||.:..:..|...|.
 Frog    66 AIATLAQSVGHISGAHLNPAVTLGCLLSCQISILKALMYIIAQCLGAVVGTAILSGITTQISNNS 130

  Fly   123 LGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTG 187
            ||...|:..:::.||||:|..:...|||.|....|..:.|...:||||||::|.||||..|.|||
 Frog   131 LGLNGLSNGVSQGQGLGVEIMVTFQLVLCVVAITDRRRNDVSGSAPLAIGLSVALGHLIAIDYTG 195

  Fly   188 ASMNPARTVGTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYR 246
            ..|||||:.|:|.....:|:||::||||::||.|||::|..:|.    |:.::.:::.:
 Frog   196 CGMNPARSFGSAVVAKQFANHWIFWVGPMIGGAAAAIIYDFILS----PRTSDLTDRMK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 97/231 (42%)
aqp1NP_001005829.1 MIP 4..234 CDD:333943 97/231 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68051
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.