DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp8a.1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001004661.1 Gene:aqp8a.1 / 447923 ZFINID:ZDB-GENE-040912-106 Length:260 Species:Danio rerio


Alignment Length:227 Identity:74/227 - (32%)
Similarity:106/227 - (46%) Gaps:21/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFAC-------GACTQIEDGTFKALAFGLAIFMAITIVGHLSGGHVNPAVT 79
            |..:.|.:|:.:..|..|       |....|:    .|||.|||:.:||.|.|.:||||.||||:
Zfish    37 QPCLAEVVGSFLFMFVGCVSVMGNVGISGSIQ----PALAHGLALAIAIAIFGEISGGHFNPAVS 97

  Fly    80 AGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPN-ITELQGLG---- 139
            ..:.:.|.:.:|....|::.|.||.:...:..|.:...|.::..  |..|.| |....|:|    
Zfish    98 VCVYLIGGMEVILLVPYIISQMLGGVIAASLAKAVTTNDAFSNA--TGAAFNAIPSSDGIGAATM 160

  Fly   140 IEFFLGLLLVLVV-FGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATD 203
            .|..:.|.|.:|| .||.:......  .||..||:.||...|.....:||.|||||..|.|..:.
Zfish   161 AEMIMTLFLTIVVSMGAVNGRTKSQ--LAPFCIGLTVTANILAGGGISGACMNPARAFGPAVVSG 223

  Fly   204 IWASHWVYWVGPVLGGVAAALLYTQVLEAKPV 235
            .|..||:|||||:.|.:....:...|:..|.|
Zfish   224 HWTHHWIYWVGPLTGALVTVSIVRLVMGDKKV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 71/216 (33%)
aqp8a.1NP_001004661.1 MIP 39..249 CDD:294134 70/217 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.760

Return to query results.
Submit another query.