DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001345242.1 Gene:aqp4 / 445293 ZFINID:ZDB-GENE-040724-152 Length:346 Species:Danio rerio


Alignment Length:239 Identity:92/239 - (38%)
Similarity:129/239 - (53%) Gaps:17/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WQALIGEFLGNLILNFFACGACTQ---------IEDGTFKALAFGLAIFMAITIVGHLSGGHVNP 76
            |:|:.||||..:|....:.|:...         ..|....:|.|||:|...:...||:||.|:||
Zfish    36 WRAVSGEFLAMIIFVLLSLGSTINWGAKQENPPPADLVLISLCFGLSIATLVQCFGHISGAHINP 100

  Fly    77 AVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIE 141
            |||..|:...::||.:..||::.|||||:.|.|.:..:.......|:|.||:...|:....:.||
Zfish   101 AVTVAMVATRKLSLAKGVFYLLAQCLGAVVGAAILYGVTPASVRGGMGVTSVNEEISAGHAIVIE 165

  Fly   142 FFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWA 206
            ..:...||..||..|||.:.|.:.:|.||||::|.:|||..|.||||||||||:.|.|.....|.
Zfish   166 LIITFELVFTVFATCDPKRNDLKGSAALAIGLSVCIGHLFAIPYTGASMNPARSFGPAVIMVKWQ 230

  Fly   207 SHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD 250
            .||||||||::||:.||.:|..:....|..|        |.:||
Zfish   231 DHWVYWVGPLIGGILAAAVYEYLFCPDPDLK--------RRYAD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 86/213 (40%)
aqp4NP_001345242.1 MIP 32..250 CDD:278651 86/213 (40%)
DUF737 <290..>345 CDD:310129
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.