DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and mipa

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001003534.1 Gene:mipa / 445140 ZFINID:ZDB-GENE-040801-41 Length:263 Species:Danio rerio


Alignment Length:246 Identity:96/246 - (39%)
Similarity:131/246 - (53%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGGHVNP 76
            :.:..|:|:..||.|.:...||..||..:...|...    |..||||....|..:||:||||:||
Zfish     5 RSMSFWRAVFAEFYGTMFFVFFGLGAALRWTTGPHNVLQVAFCFGLAAATFIQSIGHISGGHINP 69

  Fly    77 AVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIE 141
            |||...|:..::||.|||||:..|||||:||.|.:..:...:....|...:|.|.|:......||
Zfish    70 AVTFAYLIGSQMSLFRAFFYICAQCLGALAGAAVLYGVTPTNMRGNLALNTLQPGISMGMATTIE 134

  Fly   142 FFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWA 206
            .||.|.||:.||...|..:.....:|.|:||.:|.:|||..:.||||.|||||:...|.....:.
Zfish   135 IFLTLQLVVCVFAVTDERRNGRLGSAALSIGFSVLVGHLLGMYYTGAGMNPARSFAPAVLYRNFI 199

  Fly   207 SHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHADEREGCKP 257
            :||||||||::|....||||..:|    .|:|...||:...    .:|.||
Zfish   200 NHWVYWVGPMIGAAMGALLYDFML----FPRVRGLSERLAV----LKGNKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 86/213 (40%)
mipaNP_001003534.1 MIP 3..219 CDD:278651 86/213 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.