DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp10a

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001002349.1 Gene:aqp10a / 436621 ZFINID:ZDB-GENE-040718-40 Length:293 Species:Danio rerio


Alignment Length:292 Identity:68/292 - (23%)
Similarity:133/292 - (45%) Gaps:56/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNELKSKELRLWQALIGEFLGNLILNFFACGACTQIE-----DGTFKA--LAFGLAIFMAITIVG 67
            :..:|.|. .|.:.::||.||..:|..|.|.|..|::     .|.|.:  :||.:.:..|:.:..
Zfish     1 MKRMKVKN-ELARQIMGEILGTFVLLLFGCAAAAQVKTSRETKGQFLSGNIAFSVGVMSAMYLCR 64

  Fly    68 HLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQD---YYNGLGHTSLA 129
            .:||.|:||||:....|.|.::.|:...|.:.|.|||...:..| .||..|   .::|...|...
Zfish    65 AVSGAHLNPAVSLSFCVLGDLAWIKLLPYSLAQILGAYLASGLV-YLIYHDAIMEFSGGVLTVFG 128

  Fly   130 PN------------ITELQGLGIEFFLG-LLLVLVVFGACDPHK---PDS---RYTAPLAIGMAV 175
            ||            :..:|...::..:| .:|:|.:....|...   |::   ...|.:.:|:::
Zfish   129 PNETASIFATYPTDVVSVQTNFLDQVVGTAMLMLCILPLNDKRNAPAPEALLPPIVATVVLGISI 193

  Fly   176 TLGHLGTIRYTGASMNPARTVG-------TAFATDIWASH----WVYWVGPVLGGVAAALLYTQV 229
            ::.     ...||::||||.:|       ..:.|:::..:    |:..|.|::|||..:::|...
Zfish   194 SMS-----ANCGAAINPARDLGPRLFTFTAGWGTEVFTCYDYFFWIPLVAPMVGGVLGSIIYLVF 253

  Fly   230 LEAKPVPKVNEASE--------KYRTHADERE 253
            ::.. :|::.:.||        |...|.::::
Zfish   254 IQWH-LPELEDESESGEMNDQTKVMEHNNKKD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 62/253 (25%)
aqp10aNP_001002349.1 MIP 12..260 CDD:294134 60/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.