DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp3a

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_998633.1 Gene:aqp3a / 406777 ZFINID:ZDB-GENE-040426-2826 Length:296 Species:Danio rerio


Alignment Length:255 Identity:70/255 - (27%)
Similarity:109/255 - (42%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGACTQIE-----DGTFKA--LAFGLAIFMAITIVGHL 69
            ::::|.||  |.| .|.||.|||..|.||:..|::     .|.|..  ||||....:.|.:.|.:
Zfish    16 QIRNKLLR--QGL-AECLGTLILVMFGCGSLAQLKLSEGSHGLFLTANLAFGFGATLGILVCGQV 77

  Fly    70 SGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN------------- 121
            ||||:|||||..:.:.||....:...|.:||.||:..|.|    :|..:|::             
Zfish    78 SGGHLNPAVTFALCLLGREKWRKFPVYFLFQTLGSFLGAA----IIFAEYHDAIYDYAGESNELL 138

  Fly   122 --------GLGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDPH-KPDSRYTAPLAIGMAVTL 177
                    |:..|..:..:|.|.|...:......|::.:....||: .|..:......:|.:|.:
Zfish   139 VLGEKETAGIFATYPSKYLTPLNGFFDQVIGTASLIVCILAIVDPYNNPIPQGLEAFTVGFSVLI 203

  Fly   178 GHLGTIRYTGASMNPARTVGTAFATDI--WASHWV----YW-----VGPVLGGVAAALLY 226
            ..|.....:|.::||||..|....|.:  |.|...    ||     ..|.:|.|...::|
Zfish   204 IGLSMGFNSGYAVNPARDFGPRLFTAMAGWGSEVFTARDYWFLVPIFAPFIGAVIGVIVY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 69/253 (27%)
aqp3aNP_998633.1 MIP 23..266 CDD:238204 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.