DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Eglp3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611812.2 Gene:Eglp3 / 37738 FlyBaseID:FBgn0034884 Length:270 Species:Drosophila melanogaster


Alignment Length:231 Identity:80/231 - (34%)
Similarity:118/231 - (51%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GEFLGNLILNFFACGACTQ---IEDGTFKA-LAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAG 86
            ||.....:..|.||..|.:   .::..|:: |.|||||.:||...|.:||.|:|||:|....:.|
  Fly    32 GELAATAVFVFIACMGCVETPLFQNSHFRSGLTFGLAILIAIQCFGSVSGAHLNPAITLAAWLYG 96

  Fly    87 RISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGH------TSLAPNITELQGLGIEFFLG 145
            .|..|||..|.|.|..||:.|...:..::..:...|:.:      |.|||.|:.|||:.|||.:.
  Fly    97 AIGWIRAIAYFVAQAAGALIGYGLLVAVLPGNSIKGVDNPSGVCVTILAPGISVLQGVFIEFLIT 161

  Fly   146 LLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWASHWV 210
            ..||:|.....||.....:.:.|:..|:.|:...|....:|||||||.|::|.|...|.||.||:
  Fly   162 CCLVMVACSVWDPRNAKLQDSVPVRFGLTVSCLILTAGLFTGASMNPTRSLGPAVWNDSWAHHWI 226

  Fly   211 YWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYR 246
            |||||::.|...:|:|....:......:..:..|.|
  Fly   227 YWVGPLVAGAVTSLIYRMAFKGDEEIDLRTSDAKIR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 77/209 (37%)
Eglp3NP_611812.2 MIP 30..244 CDD:294134 78/211 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.