DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Eglp2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_788433.2 Gene:Eglp2 / 37737 FlyBaseID:FBgn0034883 Length:290 Species:Drosophila melanogaster


Alignment Length:248 Identity:76/248 - (30%)
Similarity:117/248 - (47%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF------KALAFGLAIFMAITIVGHLSG 71
            |:.::|.....::.|.:...:|.|..|  ...:|:..|      .||.||..:.:.|...|.:.|
  Fly    38 LQRRQLDSITTVLAEMIATAMLMFLGC--MGSVENSVFTNSDFQSALNFGFVVLICIQCFGCVCG 100

  Fly    72 GHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVK-ILIDQDYY-----NGLGHTSLAP 130
            .|:|||||....|...|||..|..|.|.|.:||..|...:| :|.:...|     ||:..|||..
  Fly   101 AHLNPAVTLATYVYNMISLPMALAYFVAQMVGAFIGYGLLKAVLPESAIYSAENPNGVCLTSLNS 165

  Fly   131 NITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPART 195
            .:|..|||.:||.:..:|:.|..|..||.....:.:.|:..|:|:....|...:.|||||||.|:
  Fly   166 TLTPWQGLAVEFLITCVLISVCCGVWDPRNATKQDSLPVRFGLAIACLSLTAGQLTGASMNPVRS 230

  Fly   196 VGTAFATDIWASHWVYWVGPVLGGVAAALLYTQV----LEAKPVPKVNEASEK 244
            ...|.....|..||:|||||:...:..:::|...    ||...|.:...::::
  Fly   231 FAPAIWNGFWDDHWIYWVGPMAAALITSVIYKHAFRRELEESEVDETTMSTKR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 72/224 (32%)
Eglp2NP_788433.2 MIP 41..261 CDD:294134 71/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.