DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Eglp1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611810.1 Gene:Eglp1 / 37736 FlyBaseID:FBgn0034882 Length:238 Species:Drosophila melanogaster


Alignment Length:240 Identity:61/240 - (25%)
Similarity:100/240 - (41%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EFLGNLILNFFACGACTQIEDGTFKALA----FGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGR 87
            ||....:|....|...:..:.|..|.|.    :||.:.:.:.:.|.:||.|.||.::....:.|.
  Fly    14 EFSATALLILLGCMGDSTNQGGESKFLVASVHYGLTVMVVMHVFGFVSGAHSNPCISISCYLMGY 78

  Fly    88 ISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN----GLGHTSLAPNITELQGLGIEFFLGLLL 148
            |:|.....|||.|..||..|...:..|:.::..:    |:........::..|.:.||..|..:|
  Fly    79 IALEVMMMYVVCQMAGAFLGYFLLMQLLPKELVDKSKPGICLVQPMDTLSTYQVVIIECLLTAVL 143

  Fly   149 VLVVFGAC---DPHKPDSRYTAPLAI--GMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWASH 208
            ||   |.|   |..  :.|:...:||  |:.|.......|:.||||||||:|:..|         
  Fly   144 VL---GWCSLWDVR--NGRFLDSVAIRMGLLVIACSFAGIQLTGASMNPAKTLVPA--------- 194

  Fly   209 WVYWVGP------VLGGVAAALL--------YTQVLEAKPVPKVN 239
             :::..|      :.|.:.||::        ||...:...:|..|
  Fly   195 -IFYGSPNSVLMQLTGQILAAIMVPFVWNHAYTPPYKPLEIPVCN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 57/225 (25%)
Eglp1NP_611810.1 MIP 13..223 CDD:294134 57/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I1546
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.