DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP7

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001161.1 Gene:AQP7 / 364 HGNCID:640 Length:342 Species:Homo sapiens


Alignment Length:270 Identity:65/270 - (24%)
Similarity:108/270 - (40%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLWQALIGEFLGNLILNFFACGACTQI----EDGTFKA--LAFGLAIFMAITIVGHLSGGHVNPA 77
            ::.:..:.||:...::..|..|:...:    :.|::..  |.||..:.|.:.:.|.:||.|:|.|
Human    32 KMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAA 96

  Fly    78 VTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGH----------------- 125
            ||......||:...:...||:.|.||:....|.:..|    :|..:.|                 
Human    97 VTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSL----FYTAILHFSGGQLMVTGPVATAGI 157

  Fly   126 --TSLAPNITELQGLGIEFFLGLLLVLVVFGACD-PHKPDSRYTAPLAIGMAVTLGHLGTIRYTG 187
              |.|..::|..:|...|.:|..:|.|.:|...| .:.|....|..|.||:.|.:..:.....||
Human   158 FATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTG 222

  Fly   188 ASMNPARTVGTAFATDI--WASH---------WVYWVGPVLGGVAAALLYTQVLEAKPVPKVN-- 239
            .::||:|.:.....|.|  |...         ||..|.|:||.....::|. |.....:|:..  
Human   223 YAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYL-VFIGSTIPREPLK 286

  Fly   240 -EASEKYRTH 248
             |.|..|..|
Human   287 LEDSVAYEDH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 58/243 (24%)
AQP7NP_001161.1 MIP 31..280 CDD:412216 60/252 (24%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P55064 94..96 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P55064 226..228 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.