DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP6

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001643.2 Gene:AQP6 / 363 HGNCID:639 Length:282 Species:Homo sapiens


Alignment Length:223 Identity:86/223 - (38%)
Similarity:116/223 - (52%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLW----QALIGEFLGNLILNFFACGAC----TQIEDGTFKALAFGLAIFMAITIVGHLSGGHVN 75
            |||    :||..|||...:..||..|:.    |.:......|:.|.|...||:.:....||.|.|
Human    18 RLWKAISRALFAEFLATGLYVFFGVGSVMRWPTALPSVLQIAITFNLVTAMAVQVTWKASGAHAN 82

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGI 140
            ||||...||...|||.||..||..|.:||..|.|.:..::..|....||...:..:::..|.:.:
Human    83 PAVTLAFLVGSHISLPRAVAYVAAQLVGATVGAALLYGVMPGDIRETLGINVVRNSVSTGQAVAV 147

  Fly   141 EFFLGLLLVLVVFGACDPHKPDSRYTA---PLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            |..|.|.|||.||.:     .|||.|:   ...||::|.||||..|.:||.||||||:.|.|...
Human   148 ELLLTLQLVLCVFAS-----TDSRQTSGSPATMIGISVALGHLIGIHFTGCSMNPARSFGPAIII 207

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVL 230
            ..:..|||:||||::|.:.|:|:|..||
Human   208 GKFTVHWVFWVGPLMGALLASLIYNFVL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 83/217 (38%)
AQP6NP_001643.2 MIP 25..231 CDD:294134 80/210 (38%)
NPA 1 82..84 1/1 (100%)
NPA 2 196..198 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.