DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP5

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001642.1 Gene:AQP5 / 362 HGNCID:638 Length:265 Species:Homo sapiens


Alignment Length:257 Identity:100/257 - (38%)
Similarity:139/257 - (54%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFFACGAC----------TQIEDGTFKALAFGLAIFMAITIVGHLSGGHVNP 76
            :|:..|||..||..||..|:.          .||      ||||||||......:|.:||||:||
Human    12 KAVFAEFLATLIFVFFGLGSALKWPSALPTILQI------ALAFGLAIGTLAQALGPVSGGHINP 70

  Fly    77 AVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIE 141
            |:|..:||..:|||:||||||..|.:|||||...:..:...:....|...:|..|.|:.|.:.:|
Human    71 AITLALLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVE 135

  Fly   142 FFLGLLLVLVVFGACDPHKPDSRYTAP-----LAIGMAVTLGHLGTIRYTGASMNPARTVGTAFA 201
            ..|...|.|.:|.:     .|||.|:|     |:||::||||||..|.:||.||||||:.|.|..
Human   136 LILTFQLALCIFAS-----TDSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVV 195

  Fly   202 TDIWA-SHWVYWVGPVLGGVAAALLYTQVL--------EAKPVPK-VNEASEKYRTHADERE 253
            .:.:: :|||:||||::|.|.||:||..:|        |...:.| ..|..|.:....:||:
Human   196 MNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 91/219 (42%)
AQP5NP_001642.1 MIP 4..221 CDD:395174 91/219 (42%)
NPA 1. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 69..71 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:18768791, ECO:0000305|PubMed:26569106 185..187 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.