DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001304313.1 Gene:AQP4 / 361 HGNCID:637 Length:352 Species:Homo sapiens


Alignment Length:218 Identity:90/218 - (41%)
Similarity:123/218 - (56%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WQALIGEFLGNLILNFFACGACTQIEDGTFK---------ALAFGLAIFMAITIVGHLSGGHVNP 76
            |:|:..|||..||....:.|: |....||.|         :|.|||:|...:...||:||||:||
Human    35 WKAVTAEFLAMLIFVLLSLGS-TINWGGTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINP 98

  Fly    77 AVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIE 141
            |||..|:...:||:.::.||:..||||||.|...:.::.......|||.|.:..|:|...||.:|
Human    99 AVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVE 163

  Fly   142 FFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWA 206
            ..:...||..:|.:||..:.|...:..||||.:|.:|||..|.||||||||||:.|.|.....|.
Human   164 LIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWE 228

  Fly   207 SHWVYWVGPVLGGVAAALLYTQV 229
            :||:|||||::|.|.|..||..|
Human   229 NHWIYWVGPIIGAVLAGGLYEYV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 87/213 (41%)
AQP4NP_001304313.1 MIP 31..248 CDD:278651 87/213 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.