DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_004916.1 Gene:AQP3 / 360 HGNCID:636 Length:292 Species:Homo sapiens


Alignment Length:295 Identity:85/295 - (28%)
Similarity:120/295 - (40%) Gaps:62/295 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSKEL------------RLWQALIGEFLGNLILNFFACGACTQI-----EDGTFKA--LAFGLAI 59
            :.|||            ||.:..:.|.||.|||..|.||:..|:     ..|.|..  ||||.|:
Human     3 RQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAV 67

  Fly    60 FMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLG 124
            .:.|.|.|.:||.|:|||||..|....|...|:...|.:.|.|||..|...|..|    ||:.:.
Human    68 TLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGL----YYDAIW 128

  Fly   125 HTS------LAPNITE-------------LQGLGIEFFLGLLLVLVVFGACDPH-KPDSRYTAPL 169
            |.:      ..||.|.             :.|...:|.....|::.|....||: .|..|.....
Human   129 HFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAF 193

  Fly   170 AIGMAVTLGHLGTIR--YTGASMNPARTVGTAFATDI--WAS-------HWVYW---VGPVLGGV 220
            .:|:.|.:  :||..  .:|.::||||..|....|.:  |.|       || :|   |.|:||.:
Human   194 TVGLVVLV--IGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQHW-WWVPIVSPLLGSI 255

  Fly   221 AAALLYTQVL--EAKPVPKVNEASEKYRTHADERE 253
            |...:|..::  ..:..|..||.......|...:|
Human   256 AGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 79/264 (30%)
AQP3NP_004916.1 MIP 23..264 CDD:238204 75/247 (30%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.