DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_000477.1 Gene:AQP2 / 359 HGNCID:634 Length:271 Species:Homo sapiens


Alignment Length:275 Identity:101/275 - (36%)
Similarity:143/275 - (52%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGAC----------TQIEDGTFKALAFGLAIFMAITIV 66
            ||:|  :...:|:..|||..|:..||..|:.          .||      |:||||.|...:..:
Human     3 ELRS--IAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQI------AMAFGLGIGTLVQAL 59

  Fly    67 GHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPN 131
            ||:||.|:|||||...||...:|::||.|||..|.|||:||.|.:..:...|....|...:|:.:
Human    60 GHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNS 124

  Fly   132 ITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTV 196
            .|..|.:.:|.||.|.|||.:|.:.|..:.::..|..|:||.:|.||||..|.|||.||||||::
Human   125 TTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSL 189

  Fly   197 GTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYR--------THADERE 253
            ..|..|..:..|||:|:||::|.:..:|||..||    .|.....||:..        |..:|||
Human   190 APAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVL----FPPAKSLSERLAVLKGLEPDTDWEERE 250

  Fly   254 GCKPN----HNPNHL 264
            ..:..    |:|..|
Human   251 VRRRQSVELHSPQSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 87/223 (39%)
AQP2NP_000477.1 MIP 3..219 CDD:278651 87/223 (39%)
NPA 1. /evidence=ECO:0000305|PubMed:24733887 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000305|PubMed:24733887 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..271 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.