DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP1

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001316801.1 Gene:AQP1 / 358 HGNCID:633 Length:323 Species:Homo sapiens


Alignment Length:263 Identity:100/263 - (38%)
Similarity:145/263 - (55%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NELKSKELRLWQALIGEFLGNLILNFFACGAC-----------TQIEDGTFKALAFGLAIFMAIT 64
            :|.|.|  ..|:|::.|||...:..|.:.|:.           |.::|....:|||||:|.....
Human     3 SEFKKK--LFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQ 65

  Fly    65 IVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLA 129
            .|||:||.|:|||||.|:|::.:||:.||..|::.||:|||..||.:..:......|.||...||
Human    66 SVGHISGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLA 130

  Fly   130 PNITELQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPAR 194
            ..:...||||||....|.|||.|....|..:.|...:||||||::|.||||..|.|||..:||||
Human   131 DGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPAR 195

  Fly   195 TVGTAFATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEAS-----------EKYRTH 248
            :.|:|..|..:::||::||||.:||..|.|:|..:|    .|:.::.:           |:|...
Human   196 SFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFIL----APRSSDLTDRVKVWTSGQVEEYDLD 256

  Fly   249 ADE 251
            ||:
Human   257 ADD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 93/224 (42%)
AQP1NP_001316801.1 NPA 1 76..78 1/1 (100%)
NPA 2 192..194 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68051
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.