DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp-12

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001022480.1 Gene:aqp-12 / 3565789 WormBaseID:WBGene00013272 Length:243 Species:Caenorhabditis elegans


Alignment Length:191 Identity:47/191 - (24%)
Similarity:86/191 - (45%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGLNELKSKELR--LWQALIGEFLGNLILNFFAC--GACTQIEDGTFKALAFGLAIFMAITIVGH 68
            |..:::|..:..  |.:..||||||.:|.:|.||  |...:..|..:..|: ..::::|..:|.|
 Worm     5 LAKSDIKHSQFHNLLIRPNIGEFLGAVIFSFLACFAGQYQRSNDLVYPFLS-AFSLYIARCLVSH 68

  Fly    69 LSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNG--LGHTSLAPN 131
            |:..|:|||::....:...|.|:....:...|.:|.:.|....:.|:.|..:|.  :.:..:|.:
 Worm    69 LTPAHLNPAISLLQWLRNEIPLVLLITFCFVQLIGFLFGVTLFRALVTQTEFNDYIVMYEIVAVD 133

  Fly   132 ----ITELQGLGIEFFLGLLLVLVVFGAC---DPHKPDSRYTAPLAIGMAVTLGHLGTIRY 185
                |..||.    |.|.::|.::.|.|.   |..:|.          :|.|.|.:..:.|
 Worm   134 GTRKINRLQA----FLLEVVLSMIFFMANALEDRQEPT----------VAATWGFIQFVSY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 46/187 (25%)
aqp-12NP_001022480.1 MIP 24..>155 CDD:294134 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.