DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and bib

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001260313.1 Gene:bib / 34330 FlyBaseID:FBgn0000180 Length:737 Species:Drosophila melanogaster


Alignment Length:229 Identity:78/229 - (34%)
Similarity:117/229 - (51%) Gaps:19/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELRLWQALIGEFLGNLILNFFACGACTQIEDGT-------FKALAFGLAIFMAITIVGHLSGGH 73
            :.|..|:::|.|.|.:.:..|..|||...:..|.       ..|||.|||:........|:||.|
  Fly    60 RTLEFWRSIISECLASFMYVFIVCGAAAGVGVGASVSSVLLATALASGLAMATLTQCFLHISGAH 124

  Fly    74 VNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL----GHTSLAPNITE 134
            :|||||..:.|...||.|||..|:..||.|.|||.|.:..:....|...|    .|::.   :..
  Fly   125 INPAVTLALCVVRSISPIRAAMYITAQCGGGIAGAALLYGVTVPGYQGNLQAAISHSAA---LAA 186

  Fly   135 LQGLGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTA 199
            .:..|:||.|..|:||..|.:.||.|.....:| .:||.|.:.....::.|    :||||::|.:
  Fly   187 WERFGVEFILTFLVVLCYFVSTDPMKKFMGNSA-ASIGCAYSACCFVSMPY----LNPARSLGPS 246

  Fly   200 FATDIWASHWVYWVGPVLGGVAAALLYTQVLEAK 233
            |..:.|.||||||.||::||:|:.|:|..:..::
  Fly   247 FVLNKWDSHWVYWFGPLVGGMASGLVYEYIFNSR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 77/220 (35%)
bibNP_001260313.1 MIP 58..273 CDD:278651 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.