DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and AQP8

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_011544124.1 Gene:AQP8 / 343 HGNCID:642 Length:262 Species:Homo sapiens


Alignment Length:220 Identity:79/220 - (35%)
Similarity:113/220 - (51%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLWQALIGEFLGNLILNFFACGACTQIEDGT-----FKALAFGLAIFMAITIVGHLSGGHVNPAV 78
            |..|..:.|.||:.:..|..|  .:.||:||     ..|||.|||:.:.|..:|::||||.||||
Human    34 RFVQPCLVELLGSALFIFIGC--LSVIENGTDTGLLQPALAHGLALGLVIATLGNISGGHFNPAV 96

  Fly    79 TAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQD-YYNGLGHTSLAPNIT-ELQG---- 137
            :...::.|.::|:....|.|.|.||.:.|.|..|.:..:: ::|..|    |..:| :.||    
Human    97 SLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASG----AAFVTVQEQGQVAG 157

  Fly   138 -LGIEFFLGLLLVLVV-FGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF 200
             |..|..|..||.|.| .||.  ::......||.:||.|||:..|.....:|..|||||..|.|.
Human   158 ALVAEIILTTLLALAVCMGAI--NEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAV 220

  Fly   201 ATDIWASHWVYWVGPVLGGVAAALL 225
            ..:.|..||:||:||:|.|:...||
Human   221 VANHWNFHWIYWLGPLLAGLLVGLL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 79/220 (36%)
AQP8XP_011544124.1 MIP 39..232 CDD:294134 69/200 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.