DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp7

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005161068.1 Gene:aqp7 / 334529 ZFINID:ZDB-GENE-030131-6461 Length:310 Species:Danio rerio


Alignment Length:276 Identity:73/276 - (26%)
Similarity:123/276 - (44%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKFEYSLG-LNELKSKELRLWQALIGEFLGNLILNFFACGACTQI--EDGTFKA-----LAFGLA 58
            |:...::| :.::|::.:|:   .:.|.|...|:..|..|...|:  .:|.|..     :.||||
Zfish     8 GRMAPNVGSMLKIKNEYIRV---ALAESLCTFIMMVFGLGTVAQVVTGEGYFGEYLSINIGFGLA 69

  Fly    59 IFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAI--AGT------AAVKILI 115
            :.|.:.:.|.:||.|:|.||:..|.|.||:.......||..|.||:.  |||      |.|.:.|
Zfish    70 VAMGVHVGGKVSGAHMNAAVSFTMCVFGRLRWKMLPLYVFAQFLGSFLAAGTIFSLYYAFVLLFI 134

  Fly   116 DQDYY--------------NGLGHTSLAPNITELQGLGIEFF-----LGLLLVLVVFGACDPHKP 161
            |...:              .|:..|..||.|:...|    ||     .||||:.::..:...::|
Zfish   135 DAINHFCGGNLTVSGPKATAGIFATYPAPYISVYTG----FFDQVAGTGLLLLCLMALSDQRNQP 195

  Fly   162 DSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVG-------TAFATDIWAS----HWVYWVGP 215
            .......:.:|:.|.|..:.....:|.::||.|.:|       ..:.|:::.:    .||..|.|
Zfish   196 LVSGGEAVGVGLLVMLIGVSMGSNSGYAINPTRDLGPRLFTLMAGWGTEVFRAGNCWWWVPLVAP 260

  Fly   216 VLGGVAAALLYTQVLE 231
            .:|||..||:|..::|
Zfish   261 FIGGVLGALIYKALVE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 69/258 (27%)
aqp7XP_005161068.1 MIP 7..275 CDD:294134 72/273 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.