DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Mindy4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001136253.1 Gene:Mindy4 / 330323 MGIID:3583959 Length:744 Species:Mus musculus


Alignment Length:147 Identity:27/147 - (18%)
Similarity:55/147 - (37%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GEFLGNLILNFFACGACTQIEDGTFKALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISL 90
            |::..:.:|......:.|..||         |..|:..::....:|.:....:|...:::..:.|
Mouse   514 GKYKADGVLETLTLYSLTSSED---------LVTFIQQSVHQFEAGPYGCILLTLSAILSRSLEL 569

  Fly    91 IRAFFYV-VFQCLGA------------IAGTAAVKI---LIDQDYYNGLGHTSLAPNITELQGLG 139
            :|..|.| ....:||            :.|.|...:   :::.|..:|        |||.|:|:.
Mouse   570 VRQDFDVPTSHLIGAHGYCTQELVNLLLTGRAVSNVFNDVVELDSGDG--------NITLLRGIE 626

  Fly   140 IEFFLGLLLVLVVFGAC 156
            ....:|.|.:...:..|
Mouse   627 ARSDIGFLSLFEHYNVC 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 27/147 (18%)
Mindy4NP_001136253.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..358
DUF4205 403..739 CDD:290609 27/147 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.