DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp8

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_062031.1 Gene:Aqp8 / 29172 RGDID:2146 Length:263 Species:Rattus norvegicus


Alignment Length:239 Identity:77/239 - (32%)
Similarity:116/239 - (48%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLGLNELKSKELRL--------W-----QALIGEFLGNLILNFFACGACTQIEDGT---FKALAF 55
            |:.|.|:|.||..:        |     |..:.|.||:.:..|..|.:..:....|   ..|||.
  Rat    10 SMDLREIKGKETNMADSYHGMSWYEQYIQPCVVELLGSALFIFIGCLSVIENSPNTGLLQPALAH 74

  Fly    56 GLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQD-Y 119
            |||:.:.|..:|::||||.||||:..:.:.|.:..:....|.|.|..|.:.|.|..|::..:: :
  Rat    75 GLALGLIIATLGNISGGHFNPAVSLAVTLVGGLKTMLLIPYWVSQLFGGMIGAALAKVVSPEERF 139

  Fly   120 YNGLGHTSLAPNITE--LQGLGIEFFLGLLLVLVV-FGACDPHKPDSRYTAPLAIGMAVTLGHLG 181
            :|..|.........|  .:.||:|..:.:||||.| .||.  ::......||.:||.:|.:..|.
  Rat   140 WNASGAAFAIVQEQEQVAEALGVEIVMTMLLVLAVCMGAV--NEKTMGPLAPFSIGFSVIVDILA 202

  Fly   182 TIRYTGASMNPARTVGTAFATDIWASHWVYWVGPVLGGVAAALL 225
            ....:||.|||||..|.|.....|..||:||:||:|.|:...||
  Rat   203 GGGISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 75/234 (32%)
Aqp8NP_062031.1 MIP 40..250 CDD:294134 69/209 (33%)
NPA 1 94..96 1/1 (100%)
NPA 2 212..214 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.