DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp6

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_071517.1 Gene:Aqp6 / 29170 RGDID:71100 Length:276 Species:Rattus norvegicus


Alignment Length:228 Identity:86/228 - (37%)
Similarity:112/228 - (49%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LW----QALIGEFLGNLILNFFACG----------ACTQIEDGTFKALAFGLAIFMAITIVGHLS 70
            ||    :||..|||...:..||..|          :..|:      |:.|.||...|:.|....|
  Rat    16 LWTAISKALFAEFLATGLYVFFGVGSVLPWPVALPSVLQV------AITFNLATATAVQISWKTS 74

  Fly    71 GGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITEL 135
            |.|.|||||...||...|||.||..|:..|..||..|.|.:..:........||...:..:.:..
  Rat    75 GAHANPAVTLAYLVGSHISLPRAVAYIAAQLAGATVGAALLYGVTPGGVRETLGVNVVHNSTSTG 139

  Fly   136 QGLGIEFFLGLLLVLVVFGACDPHKPDSRYT--APLA-IGMAVTLGHLGTIRYTGASMNPARTVG 197
            |.:.:|..|.|.|||.||.:.     |||.|  :|.| ||.:|.||||..|.:||.||||||:.|
  Rat   140 QAVAVELVLTLQLVLCVFASM-----DSRQTLGSPAAMIGTSVALGHLIGIYFTGCSMNPARSFG 199

  Fly   198 TAFATDIWASHWVYWVGPVLGGVAAALLYTQVL 230
            .|.....:|.||::||||:.|.|.|:|:|..:|
  Rat   200 PAVIVGKFAVHWIFWVGPLTGAVLASLIYNFIL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 84/222 (38%)
Aqp6NP_071517.1 MIP 22..228 CDD:294134 82/216 (38%)
NPA 1 79..81 1/1 (100%)
NPA 2 193..195 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.