DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Mip

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001099189.1 Gene:Mip / 25480 RGDID:3090 Length:263 Species:Rattus norvegicus


Alignment Length:251 Identity:95/251 - (37%)
Similarity:135/251 - (53%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGG 72
            ||:|..  .|:|:..||...|...||..|:..:...|...    |||||||:...:..|||:||.
  Rat     3 ELRSAS--FWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVALAFGLALATLVQTVGHISGA 65

  Fly    73 HVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQG 137
            |||||||...||..::||:|||.|:..|.|||:||.|.:..:........|...:|...::..|.
  Rat    66 HVNPAVTFAFLVGSQMSLLRAFCYIAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVGQA 130

  Fly   138 LGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            ..:|.||.|..||.:|...|..:.....:..||:|.::|||||..:.||||.|||||:...|..|
  Rat   131 TTVEIFLTLQFVLCIFATYDERRNGRMGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILT 195

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHADEREGCKPN 258
            ..:::||||||||::||...:|||..:|    .|::...||:...    .:|.:|:
  Rat   196 RNFSNHWVYWVGPIIGGGLGSLLYDFLL----FPRLKSVSERLSI----LKGARPS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 87/217 (40%)
MipNP_001099189.1 MIP 3..219 CDD:278651 87/217 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.