DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_037041.3 Gene:Aqp2 / 25386 RGDID:2142 Length:271 Species:Rattus norvegicus


Alignment Length:269 Identity:97/269 - (36%)
Similarity:141/269 - (52%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGG 72
            ||:|  :...:|::.|||..|:..||..|:..|.......    |:||||.|...:..:||:||.
  Rat     3 ELRS--IAFSRAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGTLVQALGHVSGA 65

  Fly    73 HVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQG 137
            |:|||||...||...:|.:||.|||..|.|||:||.|.:..:...:....|...:|..|.|..|.
  Rat    66 HINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQA 130

  Fly   138 LGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            :.:|.||.:.|||.:|.:.|..:.|:..:..|:||.:||||||..|.:||.||||||::..|..|
  Rat   131 VTVELFLTMQLVLCIFASTDERRGDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVT 195

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYR--------THADEREGCKPN- 258
            ..:..|||:|:||::|.:..:|||..:|    .|......|:..        |..:|||..:.. 
  Rat   196 GKFDDHWVFWIGPLVGAIIGSLLYNYLL----FPSAKSLQERLAVLKGLEPDTDWEEREVRRRQS 256

  Fly   259 ---HNPNHL 264
               |:|..|
  Rat   257 VELHSPQSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 85/217 (39%)
Aqp2NP_037041.3 MIP 3..219 CDD:395174 85/217 (39%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.