DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp-3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_502044.1 Gene:aqp-3 / 190553 WormBaseID:WBGene00000171 Length:421 Species:Caenorhabditis elegans


Alignment Length:292 Identity:69/292 - (23%)
Similarity:112/292 - (38%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LNELKSKELRLWQALIGEFLGNLILNFFAC--GACTQ----IEDGTFK-----ALAFGLAIFMAI 63
            :..||.| ..:...||..||..|....|..  |.|..    :..|...     ::.:||.:.:|:
 Worm   106 VERLKPK-FAIGNELIRAFLAELFCTGFLVFGGECVNAQYVLSQGKNNEWIGISVGWGLVLMLAV 169

  Fly    64 TIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL----- 123
            .:...:||.|:||||:...|..|:|:|||...|.|.|.:||..|...|..:    ||:.:     
 Worm   170 LMGSKISGAHLNPAVSFFQLTQGKINLIRFLVYAVAQNIGAFLGAFGVFCV----YYDAINVFEG 230

  Fly   124 ------GHTSLAPNITELQGLGIEFFLG------------LLLVLVVFGACDPHKPDSRYTAPLA 170
                  |.|:.|.......|.    |||            |:|.|.|....|.......:..|..
 Worm   231 GNRTVTGPTATASIFATYPGP----FLGTFNAIVDQIAGTLVLCLGVAAITDRRNGIPAFLQPAW 291

  Fly   171 IGMAVTLGHLGTIRYTGASMNPAR-------TVGTAFATDIWASH-----WVYWVGPVLGGVAAA 223
            ||..:....:......|.::||||       .:...:..::::..     |:..:.|::|||..|
 Worm   292 IGALLAFLGMSLALNAGYAINPARDFAPRLFNLCAGYGWEVFSYRNYKWFWIPIICPMIGGVLGA 356

  Fly   224 LLYT-----QVLEAKPVPKVNEASEKYRTHAD 250
            .||.     .:.:...|...:|:.::.:|..|
 Worm   357 WLYEFFIGFHIQDEDAVSLDSESDKQLKTMID 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 63/259 (24%)
aqp-3NP_502044.1 MIP 121..362 CDD:238204 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.