DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp-5

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_505691.2 Gene:aqp-5 / 183221 WormBaseID:WBGene00000173 Length:316 Species:Caenorhabditis elegans


Alignment Length:292 Identity:72/292 - (24%)
Similarity:113/292 - (38%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLGLNELKSKELRLWQAL---IGEFLGNLILNFFACGA-------CTQIEDGTFKALAFGLAIFM 61
            ::.:|..|:..:|.:..:   ..||||..|  |...|.       .:|....|..||..|||..:
 Worm    26 AMSMNSQKTSTVRPYNLISRCYAEFLGTFI--FIFSGTMQANVYDISQPVGLTHAALTHGLATIV 88

  Fly    62 AITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAG------------------- 107
            .|.:.|.:||||.||.|:..|::..::......||:..|..|..||                   
 Worm    89 VIAVFGKISGGHFNPVVSWAMVLCQKLHPFELPFYMFSQFFGGFAGNLLSACLQRKRDFLNWEDY 153

  Fly   108 --------TAAVKILIDQDYYNGL---------------GHTSLAPNITELQGLGIE-----FFL 144
                    ||:::...|:.:.:.|               |.|.|..|....:||..|     ||:
 Worm   154 SSIRYPLPTASIEYGYDKVHNSTLEKTILLTTQLAATTSGITHLGENHEWWEGLISETITTYFFV 218

  Fly   145 GLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTV-----------GT 198
            .::|:.||     .::|..  ..|..|||.|.:....|...||.:|||.|.:           .:
 Worm   219 TVILMNVV-----NNEPSE--ATPFIIGMMVIVNIFATASITGTAMNPVRALSPNIVGEIVLSSS 276

  Fly   199 AFATDIWASHWVYWVGPVLGGVAAALLYTQVL 230
            :...:.|..|::||.||.||...|.:.:..:|
 Worm   277 SLPPNFWTYHYIYWAGPYLGSTIAVIGFKLLL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 70/281 (25%)
aqp-5NP_505691.2 MIP 45..307 CDD:294134 68/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.