DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp-4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_505512.3 Gene:aqp-4 / 179366 WormBaseID:WBGene00000172 Length:273 Species:Caenorhabditis elegans


Alignment Length:228 Identity:83/228 - (36%)
Similarity:116/228 - (50%) Gaps:18/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSKELRLWQALIGEFLGNLILNFFAC--GACTQIEDGTF-KALAFGLAIFMAITIVGHLSGGHVN 75
            :.||..|....:.||||:|...:...  .:..|..||.. .|.|.|..||:.:|..||:||||.|
 Worm    37 RKKEYSLLTKCVAEFLGDLTFVYVGTMQASLFQYADGILHAAFAHGFTIFILVTAFGHISGGHFN 101

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNG--LGHTSLAPNITELQGL 138
            |||:..:..||::.:....||||.|.||.|.|......::.|:....  .|.|.|:|.....|||
 Worm   102 PAVSWAIAGAGKMPIFHLPFYVVSQLLGGICGAFLTAAVLSQEQLTSCEAGATLLSPGSQWWQGL 166

  Fly   139 GIEFFLGLLLV-LVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPART-----VG 197
            ..|..:...|| .::..|.|   .|:...||||||:.:::..|.|...|||||||||:     :|
 Worm   167 IAETVVTFFLVHTILITAAD---TDTVTLAPLAIGLTLSIDILSTGSITGASMNPARSLGPSIIG 228

  Fly   198 TAFATD----IWASHWVYWVGPVLGGVAAALLY 226
            :.|||.    .|.:|::||.||:||...|..:|
 Worm   229 SIFATQKTSFYWNNHYIYWAGPLLGSTIALCIY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 82/226 (36%)
aqp-4NP_505512.3 MIP 46..264 CDD:238204 80/219 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I3512
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I3275
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm4734
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.