DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp8

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_031500.1 Gene:Aqp8 / 11833 MGIID:1195271 Length:261 Species:Mus musculus


Alignment Length:237 Identity:78/237 - (32%)
Similarity:114/237 - (48%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLGLNELKSKELR------LW-----QALIGEFLGNLILNFFACGACTQIEDGT---FKALAFGL 57
            |:.|.|:|.|...      .|     |..|.|.:|:.:..|..|.:..:....|   ..|||.||
Mouse    10 SMDLPEVKVKTSMAGRCRVFWYEQYVQPCIVELVGSALFIFIGCLSVIENSPNTGLLQPALAHGL 74

  Fly    58 AIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQD-YYN 121
            |:.:.|..:|::||||.||||:..:.|.|.:..:....|.:.|..|.:.|.|..|::..:: ::|
Mouse    75 ALGLIIATLGNISGGHFNPAVSLAVTVIGGLKTMLLIPYWISQLFGGLIGAALAKVVSPEERFWN 139

  Fly   122 GLGHTSLAPNITE--LQGLGIEFFLGLLLVLVV-FGACDPHKPDSRYTAPLAIGMAVTLGHLGTI 183
            ..|.........|  .:.||||..|.:||||.| .||.  ::......||.:||.:|.:..|...
Mouse   140 ASGAAFAIVQEQEQVAEALGIEIILTMLLVLAVCMGAV--NEKTMGPLAPFSIGFSVIVDILAGG 202

  Fly   184 RYTGASMNPARTVGTAFATDIWASHWVYWVGPVLGGVAAALL 225
            ..:||.|||||..|.|.....|..||:||:||:|.|:...||
Mouse   203 SISGACMNPARAFGPAVMAGYWDFHWIYWLGPLLAGLFVGLL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 76/232 (33%)
Aqp8NP_031500.1 MIP 38..248 CDD:294134 71/209 (34%)
NPA 1 92..94 1/1 (100%)
NPA 2 210..212 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.