DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp7

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001365567.1 Gene:Aqp7 / 11832 MGIID:1314647 Length:316 Species:Mus musculus


Alignment Length:209 Identity:53/209 - (25%)
Similarity:90/209 - (43%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IGEFLGNLILNFFACGACTQI----EDGTFKA--LAFGLAIFMAITIVGHLSGGHVNPAVTAGML 83
            :.|||...::..|..|:...:    ..|::..  |.||..:.|.:.:.|.:||.|:|.|||....
Mouse    23 LAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMNAAVTFTNC 87

  Fly    84 VAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGH-------------------TSLA 129
            ..||::..:...||:.|.||:.:..|...::    :|..:.|                   |.|.
Mouse    88 ALGRMTWKKFPVYVLGQFLGSFSAAATTYLI----FYGAINHFAGGDLLVTGSKATANIFATYLP 148

  Fly   130 PNITELQGLGIEFFLGLLLVLVVFGACD-PHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPA 193
            ..:|..:|...|.|:..:|.|.:|...| .:.|..:.|.||.||:.||:..:.....:|.::||:
Mouse   149 EYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPS 213

  Fly   194 RTVGTAFATDI--W 205
            |.:.....|.|  |
Mouse   214 RDLPPRLFTFIAGW 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 53/209 (25%)
Aqp7NP_001365567.1 MIP 18..232 CDD:412216 53/209 (25%)
NPA 1 79..81 1/1 (100%)
NPA 2 211..213 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.