DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp3

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_057898.2 Gene:Aqp3 / 11828 MGIID:1333777 Length:292 Species:Mus musculus


Alignment Length:296 Identity:83/296 - (28%)
Similarity:122/296 - (41%) Gaps:64/296 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSKEL------------RLWQALIGEFLGNLILNFFACGACTQI-----EDGTFKA--LAFGLAI 59
            :.|||            ||.:..:.|.||.|||..|.||:..|:     ..|.|..  ||||.|:
Mouse     3 RQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAV 67

  Fly    60 FMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYN--- 121
            .:.|.:.|.:||.|:|||||..|....|...|:...|.:.|.|||..|...|..|    ||:   
Mouse    68 TLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGL----YYDAIW 128

  Fly   122 ----------------GLGHTSLAPNITELQGLGIEFFLGLLLVLVVFGACDPH-KPDSRYTAPL 169
                            |:..|..:.::..:.|...:|.....|::.|....||: .|..|.....
Mouse   129 AFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAF 193

  Fly   170 AIGMAVTLGHLGTIR--YTGASMNPARTVGTAFATDI--WAS-------HWVYW---VGPVLGGV 220
            .:|:.|.:  :||..  .:|.::||||..|....|.:  |.|       || :|   |.|:||.:
Mouse   194 TVGLVVLV--IGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHW-WWVPIVSPLLGSI 255

  Fly   221 AAALLYTQVLEA---KPVPKVNEASEKYRTHADERE 253
            |...:|..::..   :|.|...|.:.|. .|...:|
Mouse   256 AGVFVYQLMIGCHLEQPPPSTEEENVKL-AHMKHKE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 76/264 (29%)
Aqp3NP_057898.2 MIP 23..264 CDD:238204 72/247 (29%)
NPA 1. /evidence=ECO:0000250|UniProtKB:Q96PS8 83..85 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:Q96PS8 215..217 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.