DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and Aqp2

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_033829.3 Gene:Aqp2 / 11827 MGIID:1096865 Length:271 Species:Mus musculus


Alignment Length:269 Identity:98/269 - (36%)
Similarity:141/269 - (52%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGG 72
            ||:|  :...:|::.|||..|:..||..|:..|.......    |:||||.|...:..:||:||.
Mouse     3 ELRS--IAFSRAVLAEFLATLLFVFFGLGSALQWASSPPSVLQIAVAFGLGIGTLVQALGHVSGA 65

  Fly    73 HVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQG 137
            |:|||||...||...:|.:||.|||..|.|||:||.|.:..:...:....|...:|..|.|..|.
Mouse    66 HINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPVEIRGDLAVNALHNNATAGQA 130

  Fly   138 LGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            :.:|.||.:.|||.:|.:.|..:.|:..:..|:||.:||||||..|.:||.||||||::..|..|
Mouse   131 VTVELFLTMQLVLCIFASTDERRSDNLGSPALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVT 195

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYR--------THADEREGCKPN- 258
            ..:..|||:|:||::|.|..:|||..:|    .|......|:..        |..:|||..:.. 
Mouse   196 GKFDDHWVFWIGPLVGAVIGSLLYNYLL----FPSTKSLQERLAVLKGLEPDTDWEEREVRRRQS 256

  Fly   259 ---HNPNHL 264
               |:|..|
Mouse   257 VELHSPQSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 86/217 (40%)
Aqp2NP_033829.3 MIP 3..219 CDD:278651 86/217 (40%)
NPA 1. /evidence=ECO:0000250|UniProtKB:P41181 68..70 1/1 (100%)
NPA 2. /evidence=ECO:0000250|UniProtKB:P41181 184..186 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..271 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100198
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.