DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and LOC101733960

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_031752084.1 Gene:LOC101733960 / 101733960 -ID:- Length:228 Species:Xenopus tropicalis


Alignment Length:199 Identity:61/199 - (30%)
Similarity:95/199 - (47%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELRLWQALIGEFLGNLILNFFACG-ACTQI----EDGTFKALAFGLAIFMAITIVGHLSGGHVN 75
            :..|.|:.::.|.||..:|.....| :|..:    .|....|||.|..:...:...|.:||..:|
 Frog     8 RRCRFWRLVLAETLGTFMLVTVVLGSSCLGLRVSRSDSLLPALAAGFTVVSLVQCFGEISGAQLN 72

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGI 140
            ||:|:.::.|.::.|:....:.|.||:||...:|...:.:.:...|.| .|.::......|.|.:
 Frog    73 PAITSALVCARKLDLLHGMAFAVAQCVGATCASALFYVCMPESVCNQL-VTRVSSEGNAGQALAM 136

  Fly   141 EFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIW 205
            |.|....|...:|...|..:.|......||||.:||.|.|...:.:|.||||||::|.|..|.||
 Frog   137 EVFATFQLAFTIFAVDDRRRRDLTEPGSLAIGFSVTAGALTAGQVSGGSMNPARSLGPALVTGIW 201

  Fly   206 ASHW 209
            ..||
 Frog   202 EHHW 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 61/199 (31%)
LOC101733960XP_031752084.1 MIP 6..205 CDD:412216 59/197 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.