DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and LOC100509620

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006712950.1 Gene:LOC100509620 / 100509620 -ID:- Length:375 Species:Homo sapiens


Alignment Length:272 Identity:64/272 - (23%)
Similarity:108/272 - (39%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ELRLWQALIGEFLGNLILNFFACGACT-QIEDGTFKA-----LAFGLAIFMAITIVGHLSGGHVN 75
            |.::.:..:.||:...::..|..|:.. .:.:.|:.:     |.||..:.|.:.:.|.:||.|:|
Human    63 ERKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKTYGSYLGVNLGFGFGVTMGVHVAGRISGAHMN 127

  Fly    76 PAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGH--------------- 125
            .|||......||:...:...:|:.|.||:....|.:..|    :|..:.|               
Human   128 AAVTFTNCALGRVPWRKFPVHVLGQFLGSFLAAATIYSL----FYTAILHFSGGELMVTGPFATA 188

  Fly   126 ----TSLAPNITELQGLGIEFFLGLLLVLVVFGACD-PHKPDSRYTAPLAIGMAVTLGHLGTIRY 185
                |.|..::|..:|...|.:|..:|.|.:|...| .:.|....|..|.|.:.|.:..:.....
Human   189 GIFATYLPDHMTLWRGFLNEEWLTRMLQLCLFTITDQENNPALPGTHALVISILVVIIRVSHGIN 253

  Fly   186 TGASMNPARTVGTAFATDI--WASH---------WVYWVGPVLGGVAAALLYTQVLEAKPVPKVN 239
            ||.::||:|....:..|.|  |...         ||..|.|:||.....::|. |.....:|:..
Human   254 TGYAINPSRDPPPSIFTFIAGWGKQVFSDGENWWWVPVVAPLLGASLGGIIYL-VFIGSTIPREP 317

  Fly   240 ---EASEKYRTH 248
               |.|..|..|
Human   318 LKLEDSVAYEDH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 57/245 (23%)
LOC100509620XP_006712950.1 MIP 64..313 CDD:294134 58/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.