DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and LOC100491830

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_012813770.2 Gene:LOC100491830 / 100491830 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:251 Identity:87/251 - (34%)
Similarity:126/251 - (50%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QALIGEFLGNLILNFF-------------ACGACTQIEDGTFKALAFGLAIFMAITIVGHLSGGH 73
            ::|..||||.|   ||             |..|..||      :|.|||||...:..:||:|..|
 Frog    18 RSLFAEFLGTL---FFVLLGLSSTLSWPKALPAALQI------SLTFGLAIATMVQTMGHISKAH 73

  Fly    74 VNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGL 138
            :|||||...|:|..||:.:|..|:..|.|||:.|...:......:.:...|...|:...:..||.
 Frog    74 LNPAVTVAFLLAAHISISKAVLYITVQVLGAVVGAGLLYKFTPSNLHGNFGVNLLSNGTSPGQGF 138

  Fly   139 GIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATD 203
            .:|....:.|||.:|...|.|:.|:..:..::||::|||||...|.:||.||||||:...|..|.
 Frog   139 AVEVLTTMQLVLCIFATTDSHRMDNIGSPSISIGLSVTLGHFLGIYFTGCSMNPARSFAPALITG 203

  Fly   204 IWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHADEREGCKPNH 259
            .:..|||.||||:.||:.|:|:|..:|....:...|..:.....:..||||.:..|
 Frog   204 NFTDHWVVWVGPMAGGIFASLIYNFILFPSKISLRNRLAILQGNYDPEREGDREEH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 79/216 (37%)
LOC100491830XP_012813770.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.