DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp5

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001297041.1 Gene:aqp5 / 100491662 XenbaseID:XB-GENE-479726 Length:289 Species:Xenopus tropicalis


Alignment Length:259 Identity:95/259 - (36%)
Similarity:138/259 - (53%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LRLWQALIGEFLGNLILNFFACGAC----------TQIEDGTFKALAFGLAIFMAITIVGHLSGG 72
            |..|:|:..|||..||..||..|:.          .||      :|||||.|...:..|||:||.
 Frog     8 LVFWKAIFAEFLATLIFVFFGLGSALRWPAALPTVLQI------SLAFGLVIGTLVQSVGHISGA 66

  Fly    73 HVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQG 137
            |:|||||...||..:|||||||||::.|.||.:||...:..::..:....|...:|:.|||....
 Frog    67 HINPAVTMSFLVGSQISLIRAFFYIIAQLLGGLAGAGILYGVVSPNVRGNLAINTLSNNITPGVA 131

  Fly   138 LGIEFFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFAT 202
            ..:|..|...||:.:|.:.|..:.|:..:..|:||::||||||..|.:||.||||||:...|...
 Frog   132 FVVEMILTFQLVMCIFASTDSRREDNVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFAPAVVV 196

  Fly   203 DIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKY----------RTHADEREGCK 256
            ..:.:|||:|:||:.||:.|:|.|..:|    .|.....|:|.          .:.:|:::.||
 Frog   197 RRFTNHWVFWIGPLAGGMLASLTYNYIL----FPSTKTRSQKLAILLGTYVEEESWSDQQDNCK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 87/217 (40%)
aqp5NP_001297041.1 MIP 4..220 CDD:333943 87/217 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.