DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp10

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_002943404.2 Gene:aqp10 / 100490571 XenbaseID:XB-GENE-480662 Length:330 Species:Xenopus tropicalis


Alignment Length:303 Identity:82/303 - (27%)
Similarity:127/303 - (41%) Gaps:69/303 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LRLWQAL----IGEFLGNLILNFF-----ACGACTQIEDGTF--KALAFGLAIFMAITIVGHLSG 71
            |||...|    :.||||..:|...     |.|..:....|.|  ..||..:|:.:||.|.|.:||
 Frog    38 LRLRNPLARECLAEFLGVFVLLLITVAATAQGVTSNETRGNFFCMYLAGAIAVVLAIYISGGVSG 102

  Fly    72 GHVNPAVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGL-----GHTSL--- 128
            ||:|||.:..|.:.||....:...|.:.|.:|:.||.||...|    ||:.:     |:.::   
 Frog   103 GHLNPAYSLSMCILGRFPWWKLPLYALIQLVGSFAGAAAAFAL----YYDAIRDYTKGNLTVFGP 163

  Fly   129 -----------APNITELQGLGIEFFLGLLLVLV-VFGACD-PHKPDSRYTAPLAIGMAVTLGHL 180
                       ||.::...|. ::..:|..:::| :....| .:||..|...|:.:||.|....|
 Frog   164 RETASIFSSYPAPYLSIGNGF-LDQVMGTAMLMVGILAIVDSKNKPVPRGLEPIVVGMLVFCIGL 227

  Fly   181 GTIRYTGASMNPARTVGTAFATDI--WASH---------WVYWVGPVLGGVAAALLYTQVL---- 230
            ......|..:||.|.:|....|.:  |...         ||..|.|.:|.|..::|| |:|    
 Frog   228 SMGANCGYPINPTRDLGPRLFTAVAGWGLDVFRAGNNWWWVPVVAPCVGAVLGSILY-QILVEIH 291

  Fly   231 ------EAKPVPKVNEASEKYRTHADERE----GCKPNHNPNH 263
                  |.:| ||..||.::     |.:|    ....:|:.:|
 Frog   292 HPLAESEEEP-PKEKEALQE-----DTKEVQVFSINLDHSLSH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 68/250 (27%)
aqp10XP_002943404.2 MIP 38..288 CDD:294134 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.