DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and aqp4

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001304775.1 Gene:aqp4 / 100487371 XenbaseID:XB-GENE-487854 Length:345 Species:Xenopus tropicalis


Alignment Length:244 Identity:101/244 - (41%)
Similarity:135/244 - (55%) Gaps:18/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WQALIGEFLGNLILNFFACGAC--------TQIEDGTFKALAFGLAIFMAITIVGHLSGGHVNPA 77
            |:|:.||||..||....:.|:.        .|..|....||.|||:|...:...||:||||:|||
 Frog    35 WKAVTGEFLAMLIFVLLSLGSTINWSPKDNPQPADLVLIALCFGLSIATLVQCFGHISGGHINPA 99

  Fly    78 VTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEF 142
            ||..|:...:|||.::.||:|.||||||||...:.::...|....||.|.:...::...||.:|.
 Frog   100 VTVAMVSMRKISLAKSIFYIVAQCLGAIAGAGILYLVTPSDVAGNLGATMVNTKLSSAHGLLVEL 164

  Fly   143 FLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWAS 207
            .:...||..:..:|||.:.|...:..||||.:|.:|||..|.||||||||||:.|.|...:.|.|
 Frog   165 IITFQLVFTICASCDPKRKDISGSVALAIGFSVAIGHLFAIPYTGASMNPARSFGPAVIMNKWES 229

  Fly   208 HWVYWVGPVLGGVAAALLYTQVLEAKPVPK------VNEASE----KYR 246
            |||||||||||.|.|..||..|....|..|      :|:|::    ||:
 Frog   230 HWVYWVGPVLGAVIAGALYEYVYCPDPELKNHLKEVLNKATQPSKGKYK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 92/212 (43%)
aqp4NP_001304775.1 MIP 31..248 CDD:278651 92/212 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.