DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and XB5993457

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001135583.1 Gene:XB5993457 / 100216133 XenbaseID:XB-GENE-5993458 Length:268 Species:Xenopus tropicalis


Alignment Length:238 Identity:84/238 - (35%)
Similarity:133/238 - (55%) Gaps:6/238 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RLWQALIGEFLGNLILNFFACGACTQI----EDGTFKALAFGLAIFMAITIVGHLSGGHVNPAVT 79
            :.|.::.||||...:....:.|:...|    ...|..||.||.:|.:.|...||:...::||||.
 Frog    11 QFWTSMAGEFLAVFLFLVVSLGSTAGITIPGPSETHIALCFGFSIAILIHCFGHICEAYLNPAVA 75

  Fly    80 AGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFL 144
            ..|:...:||..:..||::.|||.||||...|.::...|.: .:|.|.....|:..|.|.:|..:
 Frog    76 MAMICTKKISAAKGIFYIIIQCLAAIAGAGVVALITPNDKW-PVGITKEHETISHGQALLVETLI 139

  Fly   145 GLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWASHW 209
            ...||..:|.:||..:.|.:...||.||::||:|||..|:||||||||||::||:...:.|.:||
 Frog   140 TFQLVFTIFASCDKKRSDIKVPIPLIIGLSVTIGHLFAIKYTGASMNPARSLGTSVVFNHWENHW 204

  Fly   210 VYWVGPVLGGVAAALLYTQVLEAKPVPKVN-EASEKYRTHADE 251
            :||:||::||:.|:.:|..:....|..|:. :|:...:.:.||
 Frog   205 IYWIGPMMGGILASFVYEYLFCPDPEVKLRLQANFTRQQNEDE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 78/210 (37%)
XB5993457NP_001135583.1 MIP 12..221 CDD:350945 78/209 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.