DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prip and mip

DIOPT Version :9

Sequence 1:NP_001246266.1 Gene:Prip / 36237 FlyBaseID:FBgn0033635 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001090816.1 Gene:mip / 100037914 XenbaseID:XB-GENE-484627 Length:264 Species:Xenopus tropicalis


Alignment Length:233 Identity:86/233 - (36%)
Similarity:123/233 - (52%) Gaps:8/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KELRLWQALIGEFLGNLILNFFACGACTQIEDGTFK----ALAFGLAIFMAITIVGHLSGGHVNP 76
            :....|:|:..||...:...||..||..:...|...    |||||.|:...:..|||:||.|:||
 Frog     6 RSFAFWRAIFAEFFATMFYVFFGLGASLKWAAGPANVLNIALAFGFALATLVQSVGHISGAHINP 70

  Fly    77 AVTAGMLVAGRISLIRAFFYVVFQCLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIE 141
            |||...|:..::|..||.||:..|.|||:||.|.:..:........|...::.|.::..|...:|
 Frog    71 AVTFAFLIGSQMSFFRAIFYIAAQLLGAVAGAAVLYGVTPTAVRGNLALNTIHPGVSLGQATTVE 135

  Fly   142 FFLGLLLVLVVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAFATDIWA 206
            .||.|..||.:|...|..:.....:..||:|.:|.||||..|.||||||||||:...|..|..:.
 Frog   136 AFLTLQFVLCIFATFDERRNGRMGSVSLALGFSVALGHLFGIYYTGASMNPARSFAPAVLTRNFV 200

  Fly   207 SHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEK 244
            :||||||||::||....|:|..:|    .|::...:|:
 Frog   201 NHWVYWVGPIIGGAVGGLVYDFIL----FPRMRGLNER 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PripNP_001246266.1 MIP 12..226 CDD:294134 82/213 (38%)
mipNP_001090816.1 MIP 4..220 CDD:333943 82/213 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53729
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19139
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X83
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.