DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and FPS1

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_013057.1 Gene:FPS1 / 850683 SGDID:S000003966 Length:669 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:76/313 - (24%)
Similarity:117/313 - (37%) Gaps:93/313 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LGELVGTFFLIFVGVG----STTSGSVPQIAFTFGL---------------------TVATIAQG 66
            |.|.:||..:|..|..    ...:|.:.|..|...|                     .|:::|.|
Yeast   257 LAEFMGTMVMIIFGSAVVCQVNVAGKIQQDNFNVALDNLNVTGSSAETIDAMKSLTSLVSSVAGG 321

  Fly    67 --------------LGH-------LSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAA 110
                          :|:       :||.|:||::||..|:.....:.|..:|...|.:||..||.
Yeast   322 TFDDVALGWAAAVVMGYFCAGGSAISGAHLNPSITLANLVYRGFPLKKVPYYFAGQLIGAFTGAL 386

  Fly   111 VI----KVAL----------DGVAGGDLGVSSF----DPSLNCAQAVLIEALITFILVFVVKAVS 157
            ::    |..|          :.|||      .|    .|.|:..:....|.|...:|.....|::
Yeast   387 ILFIWYKRVLQEAYSDWWMNESVAG------MFCVFPKPYLSSGRQFFSEFLCGAMLQAGTFALT 445

  Fly   158 DPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVV--------QGVWTYH----W 210
            ||.........||.:.:.|...:......:|.:||.||..||.:.        :.:|.:|    |
Yeast   446 DPYTCLSSDVFPLMMFILIFIINASMAYQTGTAMNLARDLGPRLALYAVGFDHKMLWVHHHHFFW 510

  Fly   211 VYWVGPIAGGLLAGIIYRLIFKLKKGCTPFQGHES--LWSLDALRIPVM-AWF 260
            |..|||..|.|:.|::|.:..        :|||||  .|||...:..:| |||
Yeast   511 VPMVGPFIGALMGGLVYDVCI--------YQGHESPVNWSLPVYKEMIMRAWF 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 63/275 (23%)
FPS1NP_013057.1 MIP 244..527 CDD:395174 63/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.