DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and YLL053C

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_013047.1 Gene:YLL053C / 850673 SGDID:S000003976 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:40/139 - (28%)
Similarity:65/139 - (46%) Gaps:28/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IAGAAVIKVALDGVAGGDLGVSSFDP---------SLNCAQA--VLIEALITFILVFVV--KAVS 157
            |||.|         |||  ..|:..|         .|.|:::  :.:|...|.:|...|  .||.
Yeast     7 IAGMA---------AGG--AASAMTPGKVLFTNALGLGCSRSRGLFLEMFGTAVLCLTVLMTAVE 60

  Fly   158 DPGRQDIKGSAPLAVGLAIAAGHLCAIKLSGASMNPARSFGPAVVQGVWT-YHWVYWVGPIAGGL 221
               :::....|.|.:|:::...|:.....:|..:|||||.|.||....:. |||:||:.|:.|..
Yeast    61 ---KRETNFMAALPIGISLFMAHMALTGYTGTGVNPARSLGAAVAARYFPHYHWIYWISPLLGAF 122

  Fly   222 LAGIIYRLI 230
            ||..:::|:
Yeast   123 LAWSVWQLL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 39/134 (29%)
YLL053CNP_013047.1 MIP <1..133 CDD:412216 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.831874 Normalized mean entropy S1947
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 1 0.900 - - OOG6_100198
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 1 1.000 - - X83
TreeFam 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.