DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AQY3

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_116601.1 Gene:AQY3 / 850490 SGDID:S000001840 Length:646 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:76/277 - (27%)
Similarity:106/277 - (38%) Gaps:57/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADITENKKIW-------RMLLGELVGTFFLIFVGVGST--------TSGSVPQIAFTFGLTVATI 63
            |||......|       |....|.:||..|:..|||..        :.||...::|.:|......
Yeast   331 ADIMTFPNFWAKIRYHMREPFAEFLGTLVLVIFGVGGNLQATVTKGSGGSYESLSFAWGFGCMLG 395

  Fly    64 AQGLGHLSGCHINPAVTLGFLIVGEISILKAAFYIIVQCVGAIAGAAV----IKVALDGVAGGD- 123
            ....|.:||.|||||||:...|..:....|...||:.|.:||..|.|:    ...::....||. 
Yeast   396 VYVAGGISGGHINPAVTISMAIFRKFPWKKVPVYIVAQIIGAYFGGAMAYGYFWSSITEFEGGPH 460

  Fly   124 -----LGVSSF-DPS--LNCAQAVLIEALITFILVFVVKAVSD-----PGRQDIKGSAPLAVGLA 175
                 .|...| ||.  :....|...|.:...|||..:.|:.|     ||    .|...|.:|..
Yeast   461 IRTTATGACLFTDPKSYVTWRNAFFDEFIGASILVGCLMALLDDSNAPPG----NGMTALIIGFL 521

  Fly   176 IAAGHLCAIKLSGASMNPARSFGPAVVQGV------------WTYHWVYWVGPIAGGLLAGIIYR 228
            :||..:.....:..::||||..||.:...:            |.:.|..|.||||||:...:||.
Yeast   522 VAAIGMALGYQTSFTINPARDLGPRIFASMIGYGPHAFHLTHWWWTWGAWGGPIAGGIAGALIYD 586

  Fly   229 LIFKLKKGCTPFQGHES 245
            :..        |.|.||
Yeast   587 IFI--------FTGCES 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 67/248 (27%)
AQY3NP_116601.1 MIP 348..557 CDD:238204 57/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm13431
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2356
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.