powered by:
Protein Alignment Drip and AT1G52180
DIOPT Version :9
Sequence 1: | NP_001260893.1 |
Gene: | Drip / 36236 |
FlyBaseID: | FBgn0015872 |
Length: | 278 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_175629.1 |
Gene: | AT1G52180 / 841648 |
AraportID: | AT1G52180 |
Length: | 124 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 30/74 - (40%) |
Similarity: | 42/74 - (56%) |
Gaps: | 1/74 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 QAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPA 200
|.|::|.:|||.||:.|.|.:........|: ||||:.|.:.|..|.|...||..|||.||||.:
plant 51 QRVVMEIIITFALVYTVYATAIDSNNGTLGTIAPLAIRLIVGANILAAGPFSGGPMNPGRSFGSS 115
Fly 201 VVQGVWTYH 209
:..|.::.|
plant 116 LAVGNFSGH 124
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Drip | NP_001260893.1 |
MIP |
23..227 |
CDD:294134 |
30/74 (41%) |
AT1G52180 | NP_175629.1 |
MIP |
<29..122 |
CDD:294134 |
29/70 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0580 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1152704at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000054 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.