DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drip and AT1G52180

DIOPT Version :9

Sequence 1:NP_001260893.1 Gene:Drip / 36236 FlyBaseID:FBgn0015872 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_175629.1 Gene:AT1G52180 / 841648 AraportID:AT1G52180 Length:124 Species:Arabidopsis thaliana


Alignment Length:74 Identity:30/74 - (40%)
Similarity:42/74 - (56%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QAVLIEALITFILVFVVKAVSDPGRQDIKGS-APLAVGLAIAAGHLCAIKLSGASMNPARSFGPA 200
            |.|::|.:|||.||:.|.|.:........|: ||||:.|.:.|..|.|...||..|||.||||.:
plant    51 QRVVMEIIITFALVYTVYATAIDSNNGTLGTIAPLAIRLIVGANILAAGPFSGGPMNPGRSFGSS 115

  Fly   201 VVQGVWTYH 209
            :..|.::.|
plant   116 LAVGNFSGH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DripNP_001260893.1 MIP 23..227 CDD:294134 30/74 (41%)
AT1G52180NP_175629.1 MIP <29..122 CDD:294134 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0580
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1152704at2759
OrthoFinder 1 1.000 - - FOG0000054
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.